PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.12G091800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family LBD
Protein Properties Length: 258aa    MW: 28807.3 Da    PI: 8.9111
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.12G091800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260113.21.8e-3518116199
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          aCa+Ck++r+kC +dC+lapyfpae++++f++vhk+FG+snv+kl+++++ee+r+++++slv+eA +r++dP+ G +g ++k+q++l+  
  Manes.12G091800.1.p  18 ACASCKHQRKKCGEDCILAPYFPAERSREFQAVHKVFGVSNVMKLVRSVKEEDRKTVADSLVWEAFCRQNDPILGPLGEYRKIQEELKLY 107
                          7***************************************************************************************** PP

               DUF260  91 kaelallke 99 
                          k++++++++
  Manes.12G091800.1.p 108 KNQTQTQNQ 116
                          *99998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.52717118IPR004883Lateral organ boundaries, LOB
PfamPF031954.4E-3418114IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MQRSVSNSAN SGTAAHPACA SCKHQRKKCG EDCILAPYFP AERSREFQAV HKVFGVSNVM  60
KLVRSVKEED RKTVADSLVW EAFCRQNDPI LGPLGEYRKI QEELKLYKNQ TQTQNQNQTQ  120
TQTQILNQNQ LVQQQQGSMI YKGTPGMVAW NNGINGVNNK GIEGGLPTTT TNNNNMVNFS  180
HENGSMIYSS YPLNYVQGPE KIMKQEKDVS SRLLPLQPQQ HHSIATGFNH QQQYYLPGQF  240
GSMNGKTIDN SIWEGGP*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00128DAPTransfer from AT1G06280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002525150.16e-81PREDICTED: protein LATERAL ORGAN BOUNDARIES
SwissprotQ9LNB92e-48LBD2_ARATH; LOB domain-containing protein 2
TrEMBLB9SGN17e-81B9SGN1_RICCO; LOB, putative
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127222534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.12e-47LOB domain-containing protein 2